PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000573302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 236aa    MW: 27426.5 Da    PI: 8.9379
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000573302genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-071340128
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIa 28
                     +g+WT eEd+ll ++++ lG g W+ ++
    MDP0000573302 13 KGAWTREEDDLLRRCIETLGEGKWHQVP 40
                     79**********************9987 PP

2Myb_DNA-binding50.26e-1695138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T++E +l+v+++k+lG++ W++Ia +++ gRt +++k++w++
    MDP0000573302  95 RGDFTEDEVDLIVRLHKLLGNR-WSLIAGRLP-GRTSNDVKNYWNT 138
                      899*******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.0821189IPR017877Myb-like domain
SuperFamilySSF466893.45E-61242IPR009057Homeodomain-like
SMARTSM007171.1E-81291IPR001005SANT/Myb domain
PfamPF002491.1E-51340IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-191496IPR009057Homeodomain-like
CDDcd001673.28E-51589No hitNo description
SuperFamilySSF466899.39E-2075142IPR009057Homeodomain-like
PROSITE profilePS5129423.95690144IPR017930Myb domain
SMARTSM007172.3E-1494142IPR001005SANT/Myb domain
PfamPF002492.1E-1495139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2297141IPR009057Homeodomain-like
CDDcd001673.74E-1098138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEGYNVNLSV MRKGAWTREE DDLLRRCIET LGEGKWHQVP YKAVTSAYVK RAMPRDLVPH  60
IIVHVERCXX NLGLNRCRKS CRLRWLNYLK PNIKRGDFTE DEVDLIVRLH KLLGNRWSLI  120
AGRLPGRTSN DVKNYWNTQL RIDSGVKTMK NKFQETRKTI AIRPQPQKFI QGSYYLNSKE  180
PILDHIQAAE DLSTLPQTSS STKNGNDWWX TLLEDEDAFE RIACPSLELE EEHFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-19131414102MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.75131e-178fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2533101e-177GU253310.1 Pyrus pyrifolia var. culta MYB10 protein (MYB10) mRNA, complete cds.
GenBankHM5851811e-177HM585181.1 Pyrus pyrifolia cultivar Yunnan Red MYB10 protein mRNA, complete cds.
GenBankKF3875201e-177KF387520.1 Pyrus x bretschneideri MYB transcription factor 10 (MYB10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370091.11e-134PREDICTED: transcription factor MYB90-like
SwissprotQ9FNV91e-50MY113_ARATH; Transcription factor MYB113
TrEMBLB5STY21e-124B5STY2_CYDOB; R2R3 MYB transcription factor 10
STRINGVIT_14s0006g01280.t011e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.18e-52myb domain protein 113